PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G232200.2
Common NamePHAVU_002G232200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 1790aa    MW: 200783 Da    PI: 5.2288
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G232200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1849104257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          kR+  t+ qle+Le++++ ++yps+++r eL++klgL++rq ++WF+ rR k+kk
  Phvul.002G232200.2  49 PKRQMKTPFQLETLEKAYAVDNYPSETMRGELSEKLGLSDRQLQMWFCHRRLKDKK 104
                         69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-1928104IPR009057Homeodomain-like
SuperFamilySSF466896.84E-1733104IPR009057Homeodomain-like
PROSITE profilePS5007116.64945105IPR001356Homeobox domain
SMARTSM003895.6E-1847109IPR001356Homeobox domain
PfamPF000463.1E-1649104IPR001356Homeobox domain
CDDcd000863.64E-1450104No hitNo description
PROSITE profilePS5082716.1558617IPR018501DDT domain
SMARTSM005714.5E-20558617IPR018501DDT domain
PfamPF027913.3E-16560614IPR018501DDT domain
PfamPF050662.7E-16740808IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.3E-9946988IPR028942WHIM1 domain
PfamPF156133.5E-1111221194IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1790 aa     Download sequence    Send to blast
MEEEGYSEGD NNRKRGGTDD DSNENNNNNN TNHGSSSKIV NSNEGQSKPK RQMKTPFQLE  60
TLEKAYAVDN YPSETMRGEL SEKLGLSDRQ LQMWFCHRRL KDKKDLTSKK LPRKVVVEPL  120
PESPTDDPML GPQELGNEYG SGSGSGSSPY ARVEPLNIVP RGVPGYYESP RAMMENRAIS  180
CVEAQLGEPL REDGPILGVE FDPLPPDAFG APIVTEQQKL PTFAYESKIY ERHDVRANKA  240
MTRTFRDYRS LPSQSGTRSD TSGPFSKSHL HDPIEGPARN PHLALGNETI PRIRAGQGQF  300
RGRLLSQQDK QLIPNQSPTR DDNAAPIREV DPTILNVGTS SHFTDHQIVV PENLHSQPSG  360
QVLHNNNATR IEKKRKSDDV RDGEAHEMKI RKEIEKQDNL RRKNEERMRK EIEKQDRERK  420
KEEERLMRER QREEERARRE QKRELERREK FLLKENLRVE KMKIREELRR EKEAERRKAA  480
LEKATARRIA KESMELIEDE QLEMMELAAS SKGFSSIIHL DFDTLQHVES FRDSLCVFPP  540
KSVKLKKPFA IKPWMNSEKN VGNLLMVWRF LITFADVLEL WSFTLDEFVQ AFHDYDSRLL  600
GEIHVALLKV VIKDIEDVAR TPSTGLGMNQ NGAANSGGGH PEIVEGAYAW GFDIRNWHKH  660
LNLLTWPEIF RQLALSAGYG PQLKKRSTTC SYANNKDEGR SCEDIISKLR NGSAAENAVT  720
KMHERGLLAP RRSRHRLTPG TVKFAAFHVL SLEGDKGLTV LELAEKIQKS GLRDLTTSKT  780
PEASISVALT RDTKLFERIA PSTYCVRQAF RKNPADAESI LSDARKKIQI FENGFLAEED  840
TDDVEREESE SDEVDEDPEV DDLVNSSSAN KTSGPCDDFS SNGKENLGHD VGLQGEFDKD  900
LPRFPESGSK KIDTPIAVTG KPGACEDLNV GNLGEDNMEI DESKPGESWV QGLAEGEFSD  960
LSVEERLNAL VVLVGVANEG NSIRVVLEDR LEAANALKKQ MWAEAQLDKF RLKDDIFSKS  1020
DFPSINGNKV EIQHSCSAME GNQSPSLLGN NCNNVPSPGT AENQKAAPGV QSMSIEKHSS  1080
VQDLCTGPDN PQIQTFAQYS KRSRSQLKSY IFHIAEEMCA YRSLTLGQDR RRNRYWQFVA  1140
SASSNDPGSG RIFVEFLDGN WRLIDTEEAF DALLISLDSR GVRESHLRLM LQKVESSFKE  1200
NVRKNTQCSR VGSRGETCVK NEADETDSSP DRHTGSDSPS STLCGLNSDS LETSSSFKIE  1260
LGKSESDKKS ALRRYQDFQK WTWKECYNSS ILCAMKYGKK RGKSQVVVCD ICLNPYFFED  1320
SHCNCCHRTF PSNNGFNFSK HAFQCGEKLS KDICVLDSNL PLRTRLLKAL LAHIEVSIPP  1380
EAFQSNWIED IRRHWSVKLS KSSSVEELLQ ILALLERALK RDFLSSTFST TGEQLGLNTM  1440
SENVAQTSAD SESVAVLPWV PLTTSAVSLR LFEFDESIVY LLHEKPEPSE EKEDRQYIKL  1500
PSRYNASKSI KVVETADLDC DEFMKVKSNP AKVVQNNNKR GRGSSVKGRV KNISKTKRNN  1560
GRRRSAKVAG NLNQRVKQQG GGSQGQASGR GRRTIRKRRV GKKAVEDLLL GHRGASHSSN  1620
IAKESLRSLD EEWDDEKGSP MTPIHMGTAN ISNSTEEAES DDNVQAMESD DNVQAVESDD  1680
NGQAVESDDN GQAVESDDNG QAVEYDKGNW EIGFNGNPSR WREDMVGMSD EDVEASEDEN  1740
QNENGIEENE EEDSDADADV MSEEGSDGTA NRIVNEESSD SDVSEDSSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRLKDKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159366.10.0hypothetical protein PHAVU_002G232200g
TrEMBLV7CQ340.0V7CQ34_PHAVU; Uncharacterized protein
STRINGGLYMA13G24370.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1